SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004485 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004485
Domain Number 1 Region: 198-340
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.37e-41
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000004485
Domain Number - Region: 60-115,279-311
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0602
Family beta-sandwich domain of Sec23/24 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004485   Gene: ENSTTRG00000004758   Transcript: ENSTTRT00000004759
Sequence length 568
Comment pep:novel genescaffold:turTru1:GeneScaffold_65:185774:211378:-1 gene:ENSTTRG00000004758 transcript:ENSTTRT00000004759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTILPKEPPTPDADPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSDRDRDSGVGTHPR
ASPPPQSPLPGPPGALHRWALTVQPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGATAT
GVGAAGVVVGVGSAVGVGGCCSGPGHSKRRRQAPGVGAVGGASPEREEVGAGYNSEDEYE
AAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEV
VRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYS
TGTSVVPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQS
LMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRG
PSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTVLA
LAKPPSPCAPGTSSQFSTGADRATSPLVSLYPTLECRALIQQMSPSAFGLNDWDDDEILA
SVLAVSQQEYLDSMKKNKVHRDPPPDKS
Download sequence
Identical sequences ENSTTRP00000004485 ENSTTRP00000004485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]