SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004602 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004602
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.24e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 321-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 171-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.76e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004602   Gene: ENSTTRG00000004891   Transcript: ENSTTRT00000004881
Sequence length 372
Comment pep:novel scaffold:turTru1:scaffold_97946:30221:49542:-1 gene:ENSTTRG00000004891 transcript:ENSTTRT00000004881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLPEEQLTFKDVAIEFSQEEWECLDPAQRALYRDVMLETYRNLVSLDICHIYVMKKLQPK
VNSDGGEIFQTVMLETCESREIRDFYFKEIQENMHVFEYQWRDEGNCKGMPITCKENLTY
KSNQHWKRDAGNKPVENRLGSSFQDKLLIYQTEGKIYECNQAVKSTNSRGKPYKCRQFGK
MFRRGSYLTRHQIIHTGKKSYRCDVCGKVFRRSSHLASHRTIHTGEKPYKCNECGKLFSQ
KAHLGSHQRIHSGEKPYTCNECGRAFTLRSNLIRHQKIHTGKKLYRCDICDKVFSRNSHF
ANHQRRHTEEKPYKCSECGKVFIQNSHLTRHQRIHSGEKPYTCSECGKTFNFHSNLIKHQ
KIHIGKKLYKCD
Download sequence
Identical sequences ENSTTRP00000004602 ENSTTRP00000004602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]