SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004629 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004629
Domain Number 1 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 622-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 734-791
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 678-735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 4-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-19
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 8 Region: 341-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 776-828
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 262-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000237
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 11 Region: 445-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000284
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 12 Region: 529-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000298
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 214-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000796
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004629   Gene: ENSTTRG00000004905   Transcript: ENSTTRT00000004908
Sequence length 860
Comment pep:novel genescaffold:turTru1:GeneScaffold_1266:10152:27371:-1 gene:ENSTTRG00000004905 transcript:ENSTTRT00000004908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSLGSVSFKDVTVDFSREEWQQLDLAQKSLYRDVMLENYFNLISVXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXQGIGFETSQQGMSEEVSIQFERINLFTRDDLYSILEELWQD
DEQTGRCEENQNKHLSHVAFINKDTLANEGDCEYNKDIRKMFRVNTYLVPSRKRLHNCDS
FQKSLKPIVSLCNYNRNNVTENFDKIIGYGNIFTLMNSHTEMNACGYNQCKKLLSHKQTL
IQHQKFHGENLYLFSDCVKLSTHKSHLFAHQRIYTEEKHHECSKCETVFTRKSQFAVPQV
YTREKPYICTEYGKDFSLNSNHEKTPHTEETDCKFSPHGKAFIQKSDLFRHQRIHPGGKK
PYNYNECGKNVSQNSNLNIHKKVHTGEKHFECTECGKAFTRKSTLSMHQKIHTGEKPYVC
TECGKAFIRKSHFITHERIHTGEKPYECSDCGKSFIKKSQLHVHQRIHTGENPFICSECG
KVFTHKTNLIIHQKIHTGERPYICTECEKAFTDRSNLIKHQKIHTGEKPYKCSDCGKSFT
WKSRLRIHQKCHTGERHYECSECGKAFIQKSTLSMHQRIHKGEKPYVCTECGKAFFHKSH
FITHERIHTGEKPYECSDCGKSFTKKSQLHVHQQIHTGEKPYRCAECGKAFTDRSNLFTH
QKIHTGEKPYKCNDCGKAFTRKSGLHIHQQSHTGERHYECSECGKAFARKSTLIMHQRIH
TGEKPYICTECGKSFIQKSHLNRHRRIHTGEKPYECSDCGKAFIKKTQLLEHHRIHTGEK
PYMCAECGKAFTIRSNLIKHQKIHTKQKPYKCSDFRKAFNWKVQLSVHQKSDTGEVECSV
PQSWCGDGVDEARGNQSYFI
Download sequence
Identical sequences ENSTTRP00000004629 ENSTTRP00000004629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]