SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004671 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004671
Domain Number 1 Region: 136-233
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 3.79e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 217-330
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.43e-29
Family UBX domain 0.0000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004671   Gene: ENSTTRG00000004962   Transcript: ENSTTRT00000004957
Sequence length 333
Comment pep:novel scaffold:turTru1:scaffold_92341:46546:73409:1 gene:ENSTTRG00000004962 transcript:ENSTTRT00000004957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGGGGGEAGEEGPRAVGPRPPSARDLQLALAELYEDEVKCKASKSDRPHATAFKSPR
TTPQRFYSSEHECSGLHIVRPSTGKIVNELFKEAREHGAVPLNEATRASSDDKSKSFTGG
GYRLGNSFCKRSEYIYGENQLQDVQILLKLWSNGFSLDDGELRPYSDPTNAQFLESVKRG
EIPLELQRLVHRGHVNLDMEDHHDEEYIKPRLRFKAFSGEGQKLGSLTPEIVSTPSSPEE
EEKSLLNAVVLIDDSVPTTKIQIRLADGSRLIQRFNSTHRILDVRDFIVQSRPEFAALDF
ILVTSFPNKELTDESLTLQEADILNTVILQQLK
Download sequence
Identical sequences ENSTTRP00000004671 ENSTTRP00000004671 XP_004327612.2.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]