SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004677 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004677
Domain Number 1 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.28e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 338-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 185-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-17
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004677   Gene: ENSTTRG00000004966   Transcript: ENSTTRT00000004963
Sequence length 400
Comment pep:novel genescaffold:turTru1:GeneScaffold_2715:162539:166429:-1 gene:ENSTTRG00000004966 transcript:ENSTTRT00000004963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFEDVAVELTRWEWGQLDPTQKDVYREVMLENFKNLASLGFPMSKPYVICRLEEGEEPC
ILEREISTGAPADWERRHQAKESMLSQGISKEELFRIASVEKDIRDELWSSKLKATCACD
DQLEMHPKKQERHLKEMSLTHKYTTTLRRDHEWSEFGTSLGLRSVPVNQHSVLMGEGYYK
CDTDFRETSGRNNSQRTHPGKKSCKCNECGKLFHFQSELRRHQRCHTGEKPYECSECGRA
FGHISSLIKHQRTHTGEKPYECSECGRAFSQSSSLVLHYRFHTGEKPYKCNECGRAFGHT
SSLIKHQRTHTGEKPYECRECGRTFSQSSSLIVHYRFHTGEKPYKCNRCGRAFSQSSSLT
QHYRFHTGEKPYKCNECGRAFAHTASLIKHQKSHAGKKTL
Download sequence
Identical sequences ENSTTRP00000004677 ENSTTRP00000004677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]