SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004679 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004679
Domain Number 1 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.2e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 175-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-18
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004679   Gene: ENSTTRG00000004968   Transcript: ENSTTRT00000004965
Sequence length 424
Comment pep:novel genescaffold:turTru1:GeneScaffold_2715:187930:194158:1 gene:ENSTTRG00000004968 transcript:ENSTTRT00000004965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSPTTRFQDPVTFDDVAVVFTDEEWRCLVPTQRDLYKEVMLENYKSIVSLGLPVPGP
DVIFQLKRGDEPWIVELHGSEGKECAENVSQDWETKPEIQGASEEEKSERTLREKLGMKG
PSSPKFEVHAVDGGLGTEKESPAVEACKKSLSQEERLQHGATPPKKILTKERDQECSDCG
KTFFDHSSLIRHQRTHTGEKPYDCPECGKAFSHRSSLSRHLMSHTGESPYECNACGKAFF
DRSSLTVHQRIHTGEKPFKCNECGKAFFDRSSLTRHQRIHTGESPYECNQCGKAFSQKSI
LTRHQLIHTGRKPYECNECGKAFYGVSSLNRHQKAHAGEPRYQCSECGKAFFDRSSLTQH
QKIHTGDKPYECNECGKAFSQRCRLTRHQRVHTGEKPFECSVCGKVFSSKSSVIQHQRRY
AKQE
Download sequence
Identical sequences ENSTTRP00000004679 ENSTTRP00000004679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]