SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004709 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004709
Domain Number 1 Region: 790-800,827-1189
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 4.05e-96
Family Formin homology 2 domain (FH2 domain) 0.0000227
Further Details:      
 
Domain Number 2 Region: 269-350
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-22
Family PDZ domain 0.0048
Further Details:      
 
Domain Number 3 Region: 6-77
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000933
Family PDZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004709   Gene: ENSTTRG00000004998   Transcript: ENSTTRT00000004997
Sequence length 1205
Comment pep:novel genescaffold:turTru1:GeneScaffold_1432:128723:164222:-1 gene:ENSTTRG00000004998 transcript:ENSTTRT00000004997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATNQGWPEDFGFRLGGSGPCFVLEVAEGSSAHTGGLRPGDQILEVEGLAVGGLSRERL
VRLARRCPRVPPSLGVLPGPDGGPSAGSGCAPLTTASRAPRSGRGLSLGRELLRLAGRKR
PDAVHRERRRKAQEFSRKVDEILGDQPMTKEQMFAALKQFAAEQRVDELVWALTLVLPLE
ARGPLLENLRIIPKKHRARFDEVVSQGLLGKLCRARRAQGAQRLRRSRSEERPERLLVST
RASAAPRRPDEPPQRKAASLLGSRAGPGGARRTVRVYKGNKSFGFTLRGHGPVWIESVVP
GSPADNASLKSGDRILFLNGLDMRNCSHDKVVSMLQGSGAMPTLVVEEGLVPFASDSDSM
DSPNPSSALTSLQWVAEILPSSIRVQGRTFSQQLEHLLTPPERYGVCRALESFFQHXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPEPEPELEPE
PEPEPQPRSSLRASSMCRRSLRSQGLEASLSCGPSDCAEMPRPLIPGERQAGDGTSLPET
PNPKMMSAVYAELESRLSSSFKGKMGTTSRSRASPPVPSMAGTEXXXXXXXXXXXXXRLL
PSPCYYPLCSEGLASPSSCESHPYASLDSSRAPSPQLGPGPLRSSSTPSPDPGRPPSRRK
LFTFAHPVPSRDTDRFLDALSEQLGPRVTIVDDFLSPENDYEEMSFHDDQGSFVTNERSS
ASECISSSEEGSSLTYSSISDHIPPPPLSPPPPPPLPFHDPKPSSRTPDGPWGPAPTLAK
PLTQLSHPVPPPPPPPLPPPVPCAPPMLSRGLGHRRSETSHMSVKRLRWEQVENSEGTIW
GQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPVPGPEPFRKKEVVEILSHKKAYNTSIL
LAHLKLSPAELRQVLMSMEPRRLEPAHLAQLLLFAPDADEEQRYQAFREAPGRLSEPDQF
VLQMLSVPEYKTRLRSLHFQATLQEKTEEIRGSLECLRQASLELKNSRKLAKILEFVLAM
GNYLNDGQPQTNKTTGFKINFLTELNSTKTVDGKSTFLHILAKSLSQHFPELLGFAQDLP
TVPLAAKVNQRALTSDLADLHGTISEIQAACQSMSPTSEDKFAVVMASFLETAQPVLRAL
DGLQREAMEQLGKALAFFGEDSKATTSEAFFGIFAEFMSKFERALGDLQAGEGTRSSGMI
SPLSW
Download sequence
Identical sequences ENSTTRP00000004709 ENSTTRP00000004709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]