SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004716 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004716
Domain Number 1 Region: 151-211
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 379-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 836-892
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 723-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 435-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 877-929
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 780-836
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.78e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 343-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000118
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 686-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000133
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004716   Gene: ENSTTRG00000005005   Transcript: ENSTTRT00000005004
Sequence length 1003
Comment pep:novel genescaffold:turTru1:GeneScaffold_1432:253146:264914:1 gene:ENSTTRG00000005005 transcript:ENSTTRT00000005004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALHTTPDSPAAQRERAEDGSECDPDQEEEEEEEKGEEEGELAKEEVMVVEAEDAEAVA
EVAEELEAEAEAEAEAEVEDADAEAVVAEERSPASGTQERLSCGGDAESPGLQEKALQAS
RAPAMSRGEDLEEDEDEDEDEDEDSSLASGSQGLVTFEDVAVYFSLEEWERLDADQRELY
KEVMQENYGILVSLGYPIPKPDLIFRLEQGEEPWVPDSPRPEEGDIVTGVYTGAWFWTDD
IEDHEEEDDEDFLAEVAEEENEPPGLWSAAYGVGDVPGTWGPDDSDSAQTPEGWGLDPGG
LGVLAEGSEAKPFLQGREPGASLMAPWAFPAAVTAPAGRPETTCDVCGKVFPHRSRLAKH
QRYHAAVKPFGCDECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLVTHRRIH
TGERPYRCAFCGAGFGRRSYLVTHQRTHTGERPYPCPHCGRSFIQSSALARHQAVHTADR
PHCCPDCGQAFRLRADFQRHRRGGGCAEPSGDGPRREPCETGPSAGPEEAEAGPEGTEVD
EADGEAEGEAEAREAAMEAPTPGRKDDPEPDRRILGLGNGLGEGEGPSSQPLGFHFPVHP
KSWLHPDGFPILGLPDFAERLSTDGRPLPGPLGGRLSLVEGAGLACDPFGGGAGPGGGGG
LRAFGPAVGGLLAEPAPAALAEEESPWICSDCGKTFGRRAALAKHQRYHAGERPHRCADC
GKSFVYGSHLARHRRTHTGERPFPCPECGARFARGSHLAAHVRGHTGEKPFVCGVCGAGF
SRRAHLTAHGRAHTGERPYACGECGRRFGQSAALTRHQWAHAEEKPHRCPDCGKGFGHSS
DFKRHRRTHTGEKPFRCTDCGRGFAQRSNLAKHRRGHTGERPFPCPECGKRFSQRSVLVT
HQRTHTGERPYACANCGRRFSQSSHLLTHMKTHRGTAGAPGQTPAAPAPKAEAPAKGPPS
AGAGTGSGERGSTLLEFAGGTSFGSEPTAAFAGPSGAYEESIM
Download sequence
Identical sequences ENSTTRP00000004716 ENSTTRP00000004716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]