SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004793 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004793
Domain Number 1 Region: 353-418
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000122
Family IBR domain 0.023
Further Details:      
 
Domain Number 2 Region: 281-324
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000158
Family RING finger domain, C3HC4 0.032
Further Details:      
 
Domain Number 3 Region: 51-128
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000018
Family Ubiquitin-related 0.011
Further Details:      
 
Domain Number 4 Region: 429-486
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000122
Family RING finger domain, C3HC4 0.0091
Further Details:      
 
Domain Number 5 Region: 192-220
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000381
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004793   Gene: ENSTTRG00000005104   Transcript: ENSTTRT00000005083
Sequence length 510
Comment pep:novel genescaffold:turTru1:GeneScaffold_529:25608:46871:1 gene:ENSTTRG00000005104 transcript:ENSTTRT00000005083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEKIKKAEEVAQRLTRAVAGGDEQVAMQCAIWLAEQRVPLNVQLKPEVSLTQDIRLWVS
VEDAQLHTVTIWLTVRPDMTVASLKDMVFLDYGFPPTLQQWVIGQRLARDQETLHSHGVR
RNGASAYLYLLSACNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPVPPKPGGPQD
PGRGQNDAAPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARL
AGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPTECPVCYSVLAPGEAVVLREC
LHTFCRECLQGTIRNSQEAEVACPFIDNTYSCSGKLLEREIRALLSPEDYQRFLDLGISI
AENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHINCLLCKAIHEQMNCKEYQDDLAL
RAQNDVAAWQTTEMLRTMLQQGEAMHCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPR
WGPGGPGDTSGGCRCRVNGSPCHPSCQNCH
Download sequence
Identical sequences ENSTTRP00000004793 ENSTTRP00000004793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]