SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004952 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004952
Domain Number 1 Region: 294-377
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-19
Family Ubiquitin-related 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004952   Gene: ENSTTRG00000005257   Transcript: ENSTTRT00000005252
Sequence length 522
Comment pep:novel genescaffold:turTru1:GeneScaffold_2545:253252:265199:1 gene:ENSTTRG00000005257 transcript:ENSTTRT00000005252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRPHYAQSDSTGRDSLNVRGAGKRRWAACSVTSAKVTCGAGGEPHSHRRPGMSAQTGLAP
SQGAAQGLRGPPGMQQPLQEHSHVEWNRTRGLLRASLPGTPPSKSASATAGATPPLKGAG
PLAQKPTPPCTTAVPLASRGQSPASGRFPGPAPGSKLKRGRGRAGERRRRVSIETSTCFR
PGCARLGAVTGANLSQLAFSRRPLRERVIINLRKVGAGAPDGMEEPGMDTEAETVATEGP
ARPLSCLEAEAAAGAAAEDSCAARGSLQPAPAQPPGDLAAQASVSNGEDAGGGAGRELVD
LKIIWNKTKHDVKFPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSG
AKIMVVGSTINDVLAVNTPKDAAQQDAKAEENKKEPLCRQKQHRKVLDKGKPEDVMPSVK
GAQERLPAVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGH
EDYHMMAFQLGPTEASYYWVYWVPTQYVDAIKDTVLGKWQYF
Download sequence
Identical sequences ENSTTRP00000004952 ENSTTRP00000004952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]