SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005133 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005133
Domain Number 1 Region: 129-276
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.7e-33
Family UAS domain 0.033
Further Details:      
 
Domain Number 2 Region: 386-443
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000723
Family UBX domain 0.011
Further Details:      
 
Domain Number 3 Region: 10-48
Classification Level Classification E-value
Superfamily UBA-like 0.0000578
Family TAP-C domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005133   Gene: ENSTTRG00000005445   Transcript: ENSTTRT00000005442
Sequence length 445
Comment pep:novel genescaffold:turTru1:GeneScaffold_2624:203087:259454:1 gene:ENSTTRG00000005445 transcript:ENSTTRT00000005442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSV
FNPPPSRPLQVNTADHRIYSYVVSRPQPRGLLGWGYYLIMLPFRFTYYTILDIFRFALRF
IRPDPRSRVTDPVGDIVSFMHSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGD
DHQDSDEFCRTTLCAPEVISLINTRMLFWACSTNKPEGYRVSQALRENTYPFLAMIMLKD
RRMTVVGRLKGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLAS
LWTDQEKERKKREERERKRRTEEEVQQQKLAEERRRRXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXVIHDFLFSLKESPEKFQIEANFPRRVLPCTPSEEW
PNPPTLQEAGLSHTEVLFVQDLTDE
Download sequence
Identical sequences ENSTTRP00000005133 ENSTTRP00000005133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]