SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005167 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005167
Domain Number 1 Region: 39-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.98e-39
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 304-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 388-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 215-252
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000275
Family KRAB domain (Kruppel-associated box) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005167   Gene: ENSTTRG00000005480   Transcript: ENSTTRT00000005476
Sequence length 459
Comment pep:novel genescaffold:turTru1:GeneScaffold_603:266048:273269:-1 gene:ENSTTRG00000005480 transcript:ENSTTRT00000005476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSPGFQHPPPLEQDEILIVKVEEDCCWEEEPSLEIEDPSPETFRQLFRLFCYQEVAGP
REALSRLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQARVREQQPESGEEAVVL
VEGLQREPRRQRQRDPEVVPDDALAHGTGEWFLKCQVEAQPGELSLEEGPQHSSQQPPAQ
LSHRPKRGPQLWPKTGPAASQCQETAALATSFLSAWSQVPVTLEDVAVYLSQEEWGCLDL
AQQDHSCGRLQEDEELGRQFEDGEYARADASVRTRWGQALPGLGQGPGPDPSGLQTEGGP
GVRKPHTCPECGKAFSKTSHLTKHQRTHTGERPYQCQVCGKRFGDRSNCSTHQRVHTGEK
PYACTQCGKCFSQSSSLVIHRRTHTGERPYACTECGKRFNNSSHFSAHRRTHTGEKPHTC
PACGRGFRRGTDLRKHQRTHGGAATSQTPEAPGRLGARA
Download sequence
Identical sequences ENSTTRP00000005167 ENSTTRP00000005167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]