SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005242 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005242
Domain Number 1 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.51e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.65e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.32e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 8 Region: 343-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 556-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000107
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005242   Gene: ENSTTRG00000005556   Transcript: ENSTTRT00000005556
Sequence length 616
Comment pep:novel scaffold:turTru1:scaffold_82657:11332:18180:-1 gene:ENSTTRG00000005556 transcript:ENSTTRT00000005556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLVTFKDVAIDFSQEEWEWLNPAQRSLYRSMMLENYQSLVSVGLCVSKPYVISLLEQGKE
PWEMKSEMRRTPFPDWESVYETQELPLKQFVCDDVLMGRIISYGLECPTFGEDWKCEDLF
ERQLLSQETFIRQETITHKETLTVEIDHKYNKSGKFVSLDNIEENIYNHKSDKKSFSKNS
MVIKHKKVFVGKKLFKCNECEKTFTQSSSLTVHQRIHTGEKPYECKECGKAFNQSQHLAQ
HYRIHTGEKLFECKECRKAFSQNVHLIQHQRIHTGEKPYKCKECRKAFSQPAHLAQHQRI
HTGEKPYKCKECGKAFSDGSSFARHQRCHTGKRPYVCIECGKAFRQNTSLIRHWRYYHTG
EKPFDCIDCGKAFSDHIGLIQHRRIHTGEKPYRCNVCGKTFSYGSSLTVHQRIHTGEKPY
ECDVCGKAFSHHASLTQHQRVHSGEKPYECRECGKAFRQSIHLASHLRIHTGEKPYKCKE
CGKAFSISSQLATHQRIHTGEKPYECKECGKAFKQRAHLAQHHKIHTGEKPYECTECGKA
FSQTTRLIQHQRVHTGEKPYKCTECGKAFSDSSSCSQHRRLHTGQRPYECVKCEKAYRKK
SLLICHQRCHTGEKPY
Download sequence
Identical sequences ENSTTRP00000005242 ENSTTRP00000005242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]