SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005251 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005251
Domain Number 1 Region: 407-521,641-787
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.96e-62
Family Phosphate binding protein-like 0.00000000254
Further Details:      
 
Domain Number 2 Region: 20-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-56
Family L-arabinose binding protein-like 0.0062
Further Details:      
 
Domain Number 3 Region: 537-640
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000183
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005251   Gene: ENSTTRG00000005565   Transcript: ENSTTRT00000005565
Sequence length 905
Comment pep:novel genescaffold:turTru1:GeneScaffold_2074:444839:723746:1 gene:ENSTTRG00000005565 transcript:ENSTTRT00000005565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLSAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPARIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDTSALSLSNVAGVFYILIGRXXXXXXXXXXXXXXXXXXXXXXXXG
FCLIPQQSINEAIRTSTLPRNSGAGASGGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPL
GATGL
Download sequence
Identical sequences ENSTTRP00000005251 ENSTTRP00000005251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]