SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005488 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000005488
Domain Number - Region: 531-599
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0018
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005488   Gene: ENSTTRG00000005794   Transcript: ENSTTRT00000005807
Sequence length 619
Comment pep:novel genescaffold:turTru1:GeneScaffold_365:5854:118837:1 gene:ENSTTRG00000005794 transcript:ENSTTRT00000005807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNKRLVALVPMPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGL
LYDYYKVPRDKRLLSVSKASDSQEDQDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXTNVSESPAVIPMAGITVVKAEDFTPVFTAPPVHYPRGDGEEQRVVI
FEQTQYGVPSVASHSTYLKDDQRSTPDSTYSESFKDGNTEKFRSASVGAEEYMYDQTSSG
TFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITLSETGDNKCFRHPISKVRSVVMVVFSE
DKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEIAYNAVSFTWDVNEEAK
IFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKGAERKIR
DEERKQNRKKGKGQASQTQCNNSSDGKLAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVH
FANLQRTGQXXXXXXXXXXXSSVLVKRMFRPMEEEFGPAPSKQMKEEGMKRVLLYVRKET
DDVFDALMLKSPTVRGLMEAISEKYGLPVEKITKLYKKSKKGILVNMDDNIIEHYSNEDT
FILNMESTMEGFKITLMEI
Download sequence
Identical sequences ENSTTRP00000005488 ENSTTRP00000005488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]