SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005534 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005534
Domain Number 1 Region: 46-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-37
Family SCAN domain 0.0000575
Further Details:      
 
Domain Number 2 Region: 533-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 644-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 588-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 435-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 686-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 166-223
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-17
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 9 Region: 353-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000455
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 312-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000283
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005534   Gene: ENSTTRG00000005856   Transcript: ENSTTRT00000005853
Sequence length 745
Comment pep:novel scaffold:turTru1:scaffold_96996:118005:126437:1 gene:ENSTTRG00000005856 transcript:ENSTTRT00000005853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQAGVANEMTAISPDPHTLVSSEQNKVLRMETPGDQEALLRGDTADPEFFRQRFRWFCYS
EEAGPRKALNQLWELCTQWLRPDIHTKQQILELLVFEQFLTVLPGEIKIWVRSQHPESSE
EVVTLVEELTQVLEEKEDMISQDSVISQEENPEEDKTVSVPPNTESQESMTLKDVAVTFS
RGEWRALEPSQKEIYKEVLLENYRNLEFLGFPVSKLDLVSQLKWAGLPRLLQKQASRGSR
PEESTLDKIIERYLMSGDCDLTGESWKHYGRLEECRSDREHSQVAITQKKTHGRGNKGEE
FDSEKSPFGNNFKPPSDLIKHLRVYLRKKSRRYNEGKKPFSFHSDLVPNRKEHSGEKPRK
CNEGRKALSHSSSLTEHQKHQKIHLGEKSQKCSNCGVAFTQNSSLSKRKNSSACEKCWKD
LGQDAAVDKDEGTETGEKTHKCSKCGKAFGYSASLTKHRRIHTGEKPYMCNECGKAFSDS
SSLTPHHRTHSGEKPFKCDDCGKSFTLSAHLIKHQRVHTGEKPYKCKECGRPFSDSSSLI
QHQRIHTGEKPYTCNNCGKSFSHSSSLSKHQRIHTGEKPYKCGECGKAFRQNSCLTRHQR
IHTGEKPYLCNDCGMTFSHFTSVIYHQRLHSGEKPYKCTQCEKAFPTHSLLSRHQRIHTG
VKPYKCKDCGKSFSQSSSLNEHHRIHTGEKPYECNYCGATFSRSSILVEHLKIHTGRREY
ECNECEKTFKSNSGLIRHRGFHSAE
Download sequence
Identical sequences ENSTTRP00000005534 ENSTTRP00000005534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]