SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005568 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005568
Domain Number 1 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.04e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 40-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-22
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 6 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 7 Region: 260-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000483
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 185-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000143
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005568   Gene: ENSTTRG00000005886   Transcript: ENSTTRT00000005888
Sequence length 537
Comment pep:novel genescaffold:turTru1:GeneScaffold_3275:11133:45468:-1 gene:ENSTTRG00000005886 transcript:ENSTTRT00000005888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSFAGPRTRPGEAEXXXXXXXXXXXXXXXXXXXXXXXXXGLVTFRDVAIEFSQEEWKCL
EPAQKDLYKDVTLENFSNLVSLXXXXXXXDVISLLEQGKEPWMVVNDMTGPWCPDLESRC
DKFLQKDIFEVESFDWELMESLTCCAFEGSSFRDDWAYKSQFEKQQVNHECSFKQVKITY
GNMPTFEHHTSLTLHLSNETGEKLIECNECGKAFSRGSHLIQHQKTHTGEKPFECKECGK
AFSRTSHLVQHQRIHTGEKPYDCKECGKAFGRTSELILHQRLHTGVKPYECKECGKTFRQ
HSQLILHHRTHTGEKPYVCKDCGKAFIRGSQLTVHRRIHTGARPYQCKECGKAFRQHSQL
TVHQRIHTGEKPYECKECGKGFIHSSEVTRHQRIHSGEKPYECKECGKAFRQHAQLTRHQ
RVHTGDRPYECKDCGKAFSRSSYLIQHQRIHTGDKPYECKECGKAFIRVSQLTHHQRIHT
CEKPYQCRECGMAFIRSSQLTEHQRIHPGIKPYECRECGQAFILGSQLIEHYRIHTG
Download sequence
Identical sequences ENSTTRP00000005568 ENSTTRP00000005568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]