SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005597 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005597
Domain Number 1 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 468-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 556-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.18e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 1-30
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000196
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000005597
Domain Number - Region: 154-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000884
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005597   Gene: ENSTTRG00000005922   Transcript: ENSTTRT00000005918
Sequence length 615
Comment pep:novel genescaffold:turTru1:GeneScaffold_3275:135161:141016:-1 gene:ENSTTRG00000005922 transcript:ENSTTRT00000005918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVMLENYCHLVSVGCHMTKPDVILQLGRGEEPWTSFTGHTCLEEKWKAEDFLVKFKEQQ
DKFSRSVVLINHKKLIKENSSAYEKTFTLSKNPINSKNLPPEYDTHGKIFKNVSELIISN
LSPTRKRLSEHNGYGKSLLNTKPETAHSGGKSHNHCGRTVSHNEMIMQYHEIETSAQSFG
YNDCEKSFLKKGGLITHNRAYRREKPSEYNKRRRTTNIEKKHICTECGKSFCRKSVLILH
QGIHTEEKPYQCHQCGNSFRRKSYLIDHQRTHTGEKPFVCNECGKSFRLKTALTDHQRTH
TGEKSYECPQCRNAFRLKSHLIRHQRTHTGEKPYECNDCGKSFRQKTTLSLHQRIHTGEK
PYICKECGKSFHQKANLTVHQRTHTGEKPYICNECGKSFSQKTTLALHEKTHNEEKPYIC
NECGKSFRQKTTLVAHQRTHTGEKSYECPHCGKAFRMKSYLIDHHRTHTGEKPYECNECG
KSFSQKTNLNLHQRIHTGEKPYICNECGKSFRQKATLTVHQKIXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXTGEPYKCNECGKCFRQKTNLIVHQRTHTGEKPYICNECGKSFSYKRNL
IVHQRTHKGENMVMQ
Download sequence
Identical sequences ENSTTRP00000005597 ENSTTRP00000005597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]