SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005750 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005750
Domain Number 1 Region: 31-237,298-356
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 6.47e-25
Family D-aminoacid oxidase, N-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 224-310
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.8e-21
Family D-aminoacid oxidase-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005750   Gene: ENSTTRG00000006078   Transcript: ENSTTRT00000006078
Sequence length 369
Comment pep:novel genescaffold:turTru1:GeneScaffold_2544:206286:223468:-1 gene:ENSTTRG00000006078 transcript:ENSTTRT00000006078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRPTTHWETSFGARAFGGFQGCLFRDRPMGTVRIATVGAGVMGLSTAVCISKLVPRCSIT
VISEQFSPETTSDVAAGMLIPPVYPDTPIHKQKQWFKETFDHLFTIANSAEAEDAGVLLV
SGWQIFRSIPTEEVPFWADVVLGFRKMTEDELKKFPQHVFGQAFTTLKCEGPVYLPWLEK
RLKGSGGLILTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDPKIFPVRGQVLKVQAPWVK
HFIRDGSGLTYIYPGISNVTLGGTRQKGDWNLSPDAEISKGILSRCCALEPSLHGACDIR
EKVGLRPTRPGVRLEKELLAQGSRRLPVVHHYGHGSGGIAMHWGTALEAARLVSECAQAL
RTPAPKSKL
Download sequence
Identical sequences ENSTTRP00000005750 ENSTTRP00000005750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]