SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005960 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005960
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.65e-33
Family SCAN domain 0.00014
Further Details:      
 
Domain Number 2 Region: 222-283
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 753-804
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 969-1021
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 5 Region: 503-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-17
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 830-882
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.3e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 672-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000123
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 8 Region: 458-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000371
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000984
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 10 Region: 869-922
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000803
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000005960
Domain Number - Region: 946-980
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0298
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 402-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0643
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005960   Gene: ENSTTRG00000006301   Transcript: ENSTTRT00000006301
Sequence length 1024
Comment pep:novel scaffold:turTru1:scaffold_114809:31315:38762:1 gene:ENSTTRG00000006301 transcript:ENSTTRT00000006301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWYAVHPAQAKASRERGRLQMIKKEEEDESYTSVPAARPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRTWVQLHHP
ESGGDVVALLEELQRDFYGTPWRDPALAQSPDVHWMGTGALQAAQIWPPASPLRSSSALG
DHLQPPYEIGVRDFLAGQPDPPAAQVSALSQREGCSGDLVTVQPQEAVTFKDVEVTFSQD
EWGWLDASQRNLYRDVMLENYGNVTSLVGPFTKPALISWLEAREPWGLNVQGAHPKRSPS
AAPAGNELHVKTDKFILKHEPLEEAMPSGCHGAANVSEGTGLRESFAQKSRLKEQCGNPI
QVTVKKEETNSSYGTGKDCEESGRSNSLHLKHITCLRGPRKKQSLKHGYGKHFRGSSYHC
DYKEYGKGLRRVIGGFSLHQRIHTGLKGKAKDAHGKDFSLSSHHQHGQNLHMVGTLYTCS
DCGKTFSHSSHLACHQRLHTQEKPFKCRACGKAFRWSSNRVRHEKIHTGLKPYKCSLCDK
AFRRMSAYRLHQEIHAKQKFLESYQHEEALSCGSGFDHHLRDQNGEKLFDCSQCRKFFHC
KSYILEHQRIHTQEKPYKCIKCRKTFRWRSNFTRHMRLHQEEEVCDPDKCREDFRQTSNY
SQPQSAPTVEKALLCQQCGKTFNQKKALIDHQRIHTGEKPYQCSECAEEFPHKSAFIVHK
RQHAVEIKPEDVPSFSQDGAFQVPQSSHTTEEPYKCSQCGKAFRNHSFLLIHQRVHTREK
PYKCRECGKSFRWSSNLSRHQRVHSLGKPYEYHESEDAPNLQSQILTGAKPFWCQECGKS
FTRKRSLLDHKGIHSGEKRYKCNLCGKSYDRNYRLVNHQRNHTKERPFKCQWCGKDFIGR
HTLCIHQRKHTRVAQSECSVAGLSSRQDTGVSLQELKPSEEKKPLEDCEKTCDQNSGLTG
LQDIPTGGKCHKCTTCGKTFSKSSQLISHKRFHTRERPFKCKECGKTFRWSSNLARHMKN
HTRD
Download sequence
Identical sequences ENSTTRP00000005960 ENSTTRP00000005960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]