SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006096 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006096
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000449
Family Ubiquitin-related 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006096   Gene: ENSTTRG00000006439   Transcript: ENSTTRT00000006440
Sequence length 605
Comment pep:novel genescaffold:turTru1:GeneScaffold_3089:55326:104958:-1 gene:ENSTTRG00000006439 transcript:ENSTTRT00000006440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLN
LLKIKHGDLLFLFPSSLAGPSSEMETSAPLGLKACGAPNVVEDEIDQYLSRQDGKIYRSR
DPQLCRHGPLGKCVHCVPLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKFVALEN
ISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTG
NQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIAAKLGL
RKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNICRLSPDGHFGS
KFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVF
YKDIDKFGNEITQLARPLPVEYLIIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDF
HSLATYLSQNTSSVFLDTISDFHLLLFLVTNDVMPLQDSISLLLEAVRTRNEELAQTWKK
SEQWATIEQLCSKCLTLPQPIARAQTPALQGSILLPGPWTPTPDAFASWAMEQADLCRAH
RCFHH
Download sequence
Identical sequences ENSTTRP00000006096 ENSTTRP00000006096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]