SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006122 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006122
Domain Number 1 Region: 702-1055
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.08e-93
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000729
Further Details:      
 
Domain Number 2 Region: 527-696
Classification Level Classification E-value
Superfamily ARM repeat 7.4e-59
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000324
Further Details:      
 
Domain Number 3 Region: 323-492
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.37e-46
Family PLC-like (P variant) 0.0047
Further Details:      
 
Domain Number 4 Region: 120-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-35
Family Ras-binding domain, RBD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006122   Gene: ENSTTRG00000006466   Transcript: ENSTTRT00000006467
Sequence length 1065
Comment pep:novel genescaffold:turTru1:GeneScaffold_2144:51172:159126:-1 gene:ENSTTRG00000006466 transcript:ENSTTRT00000006467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCFRFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPEK
LDSKIGVLIGRXXXXXXXXXXXXXXXXXXKMRRSEEKIQSLVGSMDWLKQTYPPEHEPSI
ENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDEVSPYD
YVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMIAIEAAIN
RNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLC
KTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKAINPSKY
QTIRKSGKVDYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQTNPYT
ENATALHIRFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKEILDRD
PLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPRE
ALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERAL
ANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLKTLNSL
IKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYIEKCKYMDSKMKP
LWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATG
DHSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSC
AGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFI
HVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLK
DSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
Download sequence
Identical sequences ENSTTRP00000006122 ENSTTRP00000006122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]