SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006191 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006191
Domain Number 1 Region: 14-69
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000795
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000006191
Domain Number - Region: 162-212
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0134
Family Ubiquitin-related 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006191   Gene: ENSTTRG00000006541   Transcript: ENSTTRT00000006541
Sequence length 326
Comment pep:novel genescaffold:turTru1:GeneScaffold_1092:742566:745707:1 gene:ENSTTRG00000006541 transcript:ENSTTRT00000006541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPGTPVQSPHPQFPHISSTMNGTSSSP
SGNHQSSFANRPRKSSVNGSSATSSG
Download sequence
Identical sequences ENSTTRP00000006191 ENSTTRP00000006191 XP_004280991.1.21590 XP_007118783.1.24612 XP_007118784.1.24612 XP_007189937.1.59432 XP_007189938.1.59432 XP_007454229.1.90284 XP_019788943.1.83887 XP_019788944.1.83887 XP_019788945.1.83887 XP_019788946.1.83887 XP_019788947.1.83887 XP_019788948.1.83887 XP_019788949.1.83887 XP_019788950.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]