SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006278 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006278
Domain Number 1 Region: 8-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.88e-24
Family Ras-binding domain, RBD 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006278   Gene: ENSTTRG00000006641   Transcript: ENSTTRT00000006634
Sequence length 419
Comment pep:novel genescaffold:turTru1:GeneScaffold_3194:377164:378636:1 gene:ENSTTRG00000006641 transcript:ENSTTRT00000006634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSEKTISVWICQEEKLVSGLSRRTTCSDVVRVLLEDGCQRRRRQRGMLCGPPQCYCIV
EKWRGFERILPNKTRILRLWDAWGDERENVRFVLVRSEASLPNAGPRSAEARVVLSRERT
CSARGVPARPSLALTQEKQRRVVRKAFRKLAKSPRAAESASVERMETLVHLVLSQDHTIR
QQVQRLRELDREIDRYEAKVHLDRMRRHGVNYVQDTYLVGAGIELDGRGPDSEAQAVELE
ELAQRCDDLLRLQEQRAQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPPEADGGLD
GELLLERERVRTQLSTSLYIGLRLNTDLEAVKSDLDYSQQQWDSKERELQGLLQTLHSLE
LTVVPDGTPVSSGPSQEPRPQACAEVWVDQARGLAKSCPGNDEDSDTGLSSMHSQDSDS
Download sequence
Identical sequences ENSTTRP00000006278 ENSTTRP00000006278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]