SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006338 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006338
Domain Number 1 Region: 632-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.81e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 521-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.61e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 577-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 409-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 465-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.64e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-23
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 7 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-22
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 312-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-18
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 9 Region: 678-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-17
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 10 Region: 249-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000482
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006338   Gene: ENSTTRG00000006707   Transcript: ENSTTRT00000006698
Sequence length 735
Comment pep:novel genescaffold:turTru1:GeneScaffold_2184:12115:90297:-1 gene:ENSTTRG00000006707 transcript:ENSTTRT00000006698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKFQEAVTFKDVAVTFTEEELGLLDSTQRKLYREVMLENFRNLLSVGHQSSKPDMISQL
EREEKLWMTEVQTQRGGHSGAGNHNEVETLHETGVRLLSLGELSCWYIKKHVVSKLTRSQ
DSVISIHRKNSQSPKQHNSPAGVSIQASVEDSCLMTLLEDHSNVIENQEFPTGRAQNSWN
KLYLNGTQNYQRSCKLTPVKNKFCIFVPCANIFSCISPHLDDDTVYKREKAHGNRECGRD
LLKASPLAPYSIIQTGPKTYQCNEREKGFRDHTSLELHQQVHLGRKSPTYRIHEKGSGYS
SASPIQQSVLPGKKRYWCHECGKGFSQSSNLQTHQRVHTGEKPYSCHECGKSFNQTSHLY
AHLPIHTGEKPYRCESCGKGFSRSTDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQAHER
IHTGEKPYKCADCGKRFSCSSNLHTHQRVHTEEKPYRCEECGKCFSLSFNLHSHQRVHTG
EKPYKCEECGKGFSSASSFQSHQRVHTGEKPFRCSVCGKGFSQSSYFQAHQRVHTGEKPY
KCEVCGKRFNWSLNLHNHQRVHTGEKPYKCEECGKGFSQASNLQAHQSVHTGEKPFKCDA
CQKRFSQASHLQAHQRVHTGEKPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCEECGKE
FSWSAGLSAHQRVHTGEKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICDICCKGFSQR
SHLVYHQRVHTGGNL
Download sequence
Identical sequences ENSTTRP00000006338 ENSTTRP00000006338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]