SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006353 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006353
Domain Number 1 Region: 344-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 231-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 6-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 272-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000184
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 5 Region: 194-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000212
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000006353
Domain Number - Region: 154-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0127
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 325-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0405
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006353   Gene: ENSTTRG00000006720   Transcript: ENSTTRT00000006715
Sequence length 418
Comment pep:novel scaffold:turTru1:scaffold_108833:95288:100783:1 gene:ENSTTRG00000006720 transcript:ENSTTRT00000006715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQITWRPEPVTFEDVTVYFTQNEWVILDPVQRALYREVMLENYANVTSLAFSFTRPVLV
SQLEGELPWGLDPWEPVGREALRGVCPGGETRNDKEESTPKEHISKEAESHGLTLGGLPG
NVPQHLGFRSHLEHSHGMVKRTKSKRRDFTDGSTRHQEACAVESGEKCEKLGKYISVSTQ
LTTNQTISSGQLSYKCGKCDRCFIRMADFHRHQRCHTGEKSFECKECGKYFRYNSLLIRH
QVIHTGKKPFKCKECGKGLSSDMALIQHQRIHTGEKPYECRECGKAFSCSPVFLQHQRFH
TGEKLHECDECWKTSSCSSSFILHQMHTGEKPCECKECGKLSSNIALTQHQRIHTGEKPF
ECKECGKAFNQKITLVQHEHGHTGEKPYECKVCGKTFSWCGRFILHQKLHVQKTSVQE
Download sequence
Identical sequences ENSTTRP00000006353 ENSTTRP00000006353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]