SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006519 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006519
Domain Number 1 Region: 207-289
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000121
Family Ras-binding domain, RBD 0.036
Further Details:      
 
Domain Number 2 Region: 45-100
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000977
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006519   Gene: ENSTTRG00000006895   Transcript: ENSTTRT00000006895
Sequence length 342
Comment pep:novel genescaffold:turTru1:GeneScaffold_2960:63233:71781:-1 gene:ENSTTRG00000006895 transcript:ENSTTRT00000006895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEPELIELRDLAPARCAAPGRTRLERANALRIAPGTARNAARQLVPGRGHRFQAGTTH
TWCDLCGDFXXXXXXXXXXXXXCKFTCHYRCRALVCLDCCGPRDLGWEPALERDTNVPIF
QDEPVEWETPDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPA
SKKPPSLQDARRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDD
PRKFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSM
PELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
Download sequence
Identical sequences ENSTTRP00000006519 ENSTTRP00000006519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]