SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006566 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006566
Domain Number 1 Region: 170-295
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.7e-67
Family RUNT domain 0.000000327
Further Details:      
 
Domain Number 2 Region: 107-150
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000994
Family beta-sandwich domain of Sec23/24 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006566   Gene: ENSTTRG00000006943   Transcript: ENSTTRT00000006943
Sequence length 587
Comment pep:novel genescaffold:turTru1:GeneScaffold_1482:745731:955996:1 gene:ENSTTRG00000006943 transcript:ENSTTRT00000006943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHSPHKQPQNHKCGANFLQEDSKKSLVFKWLISAGHYQPSRPTESFKAASRIYNRGYKF
YLKIKGGTMASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQ
QQQQQQQQQQQQQQQQQQQAAEAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELV
RTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAV
MKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKL
DDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQTQSS
PPWSYDQSYPSYLSQMTPPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPS
TLSKKSQAGASELGPFSDPRQFSSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSA
TTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCT
TTSNGSALLNANLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
Download sequence
Identical sequences ENSTTRP00000006566 ENSTTRP00000006566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]