SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006570 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006570
Domain Number 1 Region: 307-335,367-568
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.16e-59
Family Voltage-gated potassium channels 0.00058
Further Details:      
 
Domain Number 2 Region: 180-276
Classification Level Classification E-value
Superfamily POZ domain 8.9e-27
Family Tetramerization domain of potassium channels 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006570   Gene: ENSTTRG00000006950   Transcript: ENSTTRT00000006947
Sequence length 656
Comment pep:novel scaffold:turTru1:scaffold_108418:484392:486383:-1 gene:ENSTTRG00000006950 transcript:ENSTTRT00000006947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGGGGSGGG
AHHHHHHQLRGACTSQDPQSGRGSRRRRRQRPEKKKVHHRQSSFPHCSDLMPSGSEEKIL
RDLSEEEEEEEEEEEEEEEGRFRYSEDDRGDECSYTDLLPQDDAGGGGGYSSVRYSDCCE
RVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQ
SGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQVWLL
FEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLITALSTGGHSGLLNDTSA
PHPENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYF
ITLGTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMR
ELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVG
GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKK
FRSSTSSSLGDKSEYLEMEEGVKESLCAKEKCQGKGDDSETDKNNCSNAKAVETDV
Download sequence
Identical sequences ENSTTRP00000006570 ENSTTRP00000006570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]