SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006619 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006619
Domain Number 1 Region: 1010-1165,1203-1283
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-42
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1332-1529,1556-1581
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.75e-37
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 554-701,735-782
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-31
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 130-275,361-430
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.47e-29
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000006619
Domain Number - Region: 1585-1630
Classification Level Classification E-value
Superfamily EF-hand 0.0499
Family Calmodulin-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006619   Gene: ENSTTRG00000006995   Transcript: ENSTTRT00000006999
Sequence length 1816
Comment pep:novel genescaffold:turTru1:GeneScaffold_3375:120728:147920:-1 gene:ENSTTRG00000006995 transcript:ENSTTRT00000006999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSSLPTVVPLGPESLRPFTRESQAAIERRVMEEEARQQRNKQMEIEEPEQKPCSDLEA
GKSLPLIYGDPPPEVIGIPLEELDPYYSDKKTFIVLNKGKAIFRFSATPALYVLSPFSTL
RRYAIKVLIHSLFSMFIMITILTNCVFMTMSDPPSWSKHVEYTFTGIYTFESLIKILARG
FCIEDFTFLRDPWNWLDFSVIMMAYLTEFVDLGNISALRTFRVLRALKTITVIPGLKTIV
GALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVRWPPPFNDTNTTWYGNDTW
DGQESWASNSTFDWDAYINDEGNFYFLEGSNDALLCGNSSDAGRCPEGYECIKAGRNPNY
GYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINLILA
VVAMAYAEQNEATLAENQEKEEEFQQMLEKFKKQQEEVGKAKAAQALEGREADEDPAHGK
DCNGSLDTSAGEKGPPRPSCSADSGISDAMEELEEAHQKCPPWWYKCSQKVLIWNCCTPW
MKFKNIVHLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEQFDRVLNVGNLVFTGIFTAE
MVLKLIAMDPYEYFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKSWP
TLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIAADCNLPRWHM
HDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTVFLMVMVIGNLVVLNLFLALLLSS
FSADSLAASDEDGEMNNLQIAVTRIKWGVGFAKAFLVGLLHGKILSPKVIMLSLGGTGEA
GEAGEAGESVSEDEKKELPPEEDENKDLKKDNHILNHMGLADGPPPSIELDHLNFINNPY
LTIHVPIASEESDLEMPTEEETDTFSEPEDGKKPLQPLDGNSSVCSTADYKPPEEDPEEQ
AEESPEGEQPEECFTEACVQRFPCLYVDISQGRGKMWWTLRRACFKIVEHNWFETFIVFM
ILLSSGALAFEDIYIEQRRVIRTILEYADKVFTYIFIMEMLLKWVAYGFKVYFTNAWCWL
DFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSI
MNVLLVCLIFWLIFSIMGVNLFAGKFYYCMNTTTSERFDISEVNNKSECESLMHTGQVRW
LNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKEEQPQYEVNIYMYLYFVIFII
FGSFFTLNLFIGVIIDNFQQKKKFGGKDLFMTEEQKKYYNAMKKLGSKKPQKPIPRPQNK
IQGMVYDLVTQQAFDITIMILICLNMVTMMVETDDQSQLKVDILYNVNMVFIIIFTGECM
LKMLALRQYYFTIGWNIFDFVVVILSIVGLALSDLIQKYFVSPTLFRVIRLARIGRVLRL
IRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNFAYVKKESGIDDMFNFET
FGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPALENPGTSVRGDCGNPSIGICFFCSY
IIISFLIVVNMYIAIILENFNVATEESSEPLGEDDFEMFYETWEKFDPDATQFIDYSRLS
DFVDTLQEPLRLAKPNKIKLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKETM
EEKFMAANPSKVSYEPITTTLKRKHEEVCAVKIQRAYRRHLLQRSVKQASYMYRHSQDSS
GDAAPEKEGLIADTMNKMYGPENGNSGLQSKGEWRGSTWDPRPALGLLSIRPTDTALPPA
PPPGQTVRPGVKESLV
Download sequence
Identical sequences ENSTTRP00000006619 ENSTTRP00000006619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]