SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006880 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006880
Domain Number 1 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 166-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 115-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 404-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-16
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 213-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000524
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006880   Gene: ENSTTRG00000007271   Transcript: ENSTTRT00000007270
Sequence length 461
Comment pep:novel scaffold:turTru1:scaffold_90552:42513:48998:-1 gene:ENSTTRG00000007271 transcript:ENSTTRT00000007270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGLVTFSDVAIDFSQEEWACLDSTQRDLYWDVMLENYSNLVSLDLESPYETKSLPTQK
GTYEINFSKQNSNRKSKSLGLDWMCEGEFEGPQAPQEGYINQINCGKTPTCRENTSVRPH
QRLHNRENSYECKECGKAFSRGYQLTQHQKIHTGEKPYECKECKKAFRWGNQLTQHQKIH
TGEKPYECKDCGKAFRWGSSLVIHKRIHTGEKPYECKDCGKAFRRGDELTQHQRFHTGEK
DYECKDCGKTFSRVYKLIQHKRIHSGEKPYECKDCGKAFICGSSLVQHKRIHTGEKPYEC
QECGKAFTRVNYLTQHQKIHTGEKPHECKECGKAFRWGSSLVKHERIHTGEKPYKCTECG
KAFNCGYHLTQHERIHTGETPYKCKECGKAFIYGSSLVKHERIHTGEKPYECKECGKAFS
HGHQLTQHQKIHTGEKPSECKECGKACKRVDHPPEHQRIHC
Download sequence
Identical sequences ENSTTRP00000006880 ENSTTRP00000006880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]