SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007073 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007073
Domain Number 1 Region: 10-49
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000258
Family Ubiquitin-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007073   Gene: ENSTTRG00000007476   Transcript: ENSTTRT00000007476
Sequence length 405
Comment pep:novel genescaffold:turTru1:GeneScaffold_1093:201122:242274:-1 gene:ENSTTRG00000007476 transcript:ENSTTRT00000007476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPXXXXXXXXXXX
XXXXXXXXXXXXXXXQDEYHMVHLVCTSRTPPSSPKSSTSRQSHEALTSSSNSXXXXXXX
XXXXXXQETLSLATSSSSEGLRQNLPQAQTDPAQSHQFPYVMQGNVDNQLPGQAVPAGFP
VYPAFSPLQMLWWQQMYAHQYYMQYQAAVSAQATSNANPAQPAASQPLNLAHVPGEEPPP
APNLVAQENRPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSFSR
FIMVMGAMLLVYLHQAGWFPFRQEGGQQQAPNNNAEVNNDVQNANNLELEEMERLMDDGL
EDESGEDAGEDASAIQRPGLMASAWSFITTFFTSLIPEGPPQVAN
Download sequence
Identical sequences ENSTTRP00000007073 ENSTTRP00000007073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]