SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007189 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007189
Domain Number 1 Region: 272-338
Classification Level Classification E-value
Superfamily XPC-binding domain 5.76e-24
Family XPC-binding domain 0.0000201
Further Details:      
 
Domain Number 2 Region: 5-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.68e-18
Family Ubiquitin-related 0.0000263
Further Details:      
 
Domain Number 3 Region: 175-231
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000584
Family UBA domain 0.00064
Further Details:      
 
Domain Number 4 Region: 356-407
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000163
Family UBA domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007189   Gene: ENSTTRG00000007597   Transcript: ENSTTRT00000007601
Sequence length 409
Comment pep:novel genescaffold:turTru1:GeneScaffold_1016:155321:205996:1 gene:ENSTTRG00000007597 transcript:ENSTTRT00000007601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVTLTLQQQTFXXXXXXXXXVRALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKE
YKIDEKNFVVVMVTKPKAVTTPAPATTQQSNSATTTTVSSSTAPTVVQAPTPAPTLAPAP
APTPASVTPASTTASSEPAPASATKQEKPAEKPAETPVAASPTSTDSTSGDSSRSNLFED
ATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVV
DPPPAASTGAPQSSVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGSGGGSGGIAEAGSGHMNYI
QVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Download sequence
Identical sequences ENSTTRP00000007189 ENSTTRP00000007189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]