SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007320 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007320
Domain Number 1 Region: 289-687,768-773,804-846
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.21e-88
Family FAD-linked reductases, N-terminal domain 0.00000000000575
Further Details:      
 
Domain Number 2 Region: 184-290
Classification Level Classification E-value
Superfamily Homeodomain-like 1.79e-30
Family SWIRM domain 0.00000121
Further Details:      
 
Domain Number 3 Region: 672-780
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.83e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007320   Gene: ENSTTRG00000007737   Transcript: ENSTTRT00000007740
Sequence length 869
Comment pep:novel genescaffold:turTru1:GeneScaffold_3587:34870:98607:1 gene:ENSTTRG00000007737 transcript:ENSTTRT00000007740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSWKASVAAAAVTVAAGSEAGSGAAGXFVPAPPAGLSGPAEAGPGAAGERTPRKKEPPR
SSPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRCKRAKVEYREMDESL
ANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGGLQDDSSGGYG
DGQASGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKI
QLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSG
VSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSK
QVNMELAKIKQKCPLYEANGQADTVKVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNN
KPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXCKEYDELAETQGKLEEKLQELEANPPSDVYLSS
RDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLD
IKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPL
PEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPIL
LALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSY
VAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAG
RIADQFLGAMYTLPRQATPGVPAQQSPSM
Download sequence
Identical sequences ENSTTRP00000007320 ENSTTRP00000007320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]