SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007330 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007330
Domain Number 1 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 175-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.26e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 399-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 287-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 7-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-21
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 7 Region: 122-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 446-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000511
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007330   Gene: ENSTTRG00000007756   Transcript: ENSTTRT00000007752
Sequence length 470
Comment pep:novel genescaffold:turTru1:GeneScaffold_3587:345760:350392:-1 gene:ENSTTRG00000007756 transcript:ENSTTRT00000007752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLLMAGSQAPVTFEDMAMYLTREEWRPLDPTQRDLYRDVMQENYGNVVSLDFEIRSE
NEVNPKQEISEDVEFGTASERPVGNTEDSPESEEAFENRDRSERQWGDLTAEEWVSYPLQ
QVTDLLVHKEVHTSIRYHICSHCGKAFGQISDLNRHQKIHTGDRPYKCYECGKGFSRSSH
LIQHQRTHTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCNECGKSFCRLSHLIQH
QRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECNECGRGFSERSDLIKHYRVH
TGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQRTHTGEK
PYECNACGKSFSRSSHLITHQKIHTGEKPYECNECWRSFGERSDLIKHQRTHTGEKPYEC
VQCGKGFTQSSNLITHQRVHTGEKPYECTECEKSFSRSSALIKHKRVHTD
Download sequence
Identical sequences ENSTTRP00000007330 XP_004316259.1.83887 ENSTTRP00000007330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]