SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007493 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007493
Domain Number 1 Region: 232-311
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000518
Family Ubiquitin-related 0.002
Further Details:      
 
Domain Number 2 Region: 149-227
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000172
Family Ubiquitin-related 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007493   Gene: ENSTTRG00000007918   Transcript: ENSTTRT00000007919
Sequence length 312
Comment pep:novel genescaffold:turTru1:GeneScaffold_2923:60939:69213:1 gene:ENSTTRG00000007918 transcript:ENSTTRT00000007919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRRRRQLLLDPEEAPAVPVYSEKVKSSLHLIPDHKSLLKFCPPETEEEADMADSSSLHAE
DSPRPNSPWKKKLRSRDGEEKKEMLLVQDTSPLPPRLPRTNSRKHARALQKLREVNKRLQ
DLRSCLSPKQPQGQDHLSQEDEVVLLEGPTLPENPRLLPLKIQCRADLIRLPVRMSEPLQ
SVVDHMAGRLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLASSPDVTEKSHL
LQLRVQGKEKHQLLEVSLPRDSPLKTLMSRYEEAMGLSGRKLSFFFDGTKLSGKELPADL
GMESGDLIEVWS
Download sequence
Identical sequences ENSTTRP00000007493 ENSTTRP00000007493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]