SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007519 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007519
Domain Number 1 Region: 18-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000192
Family Ubiquitin-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007519   Gene: ENSTTRG00000007946   Transcript: ENSTTRT00000007945
Sequence length 308
Comment pep:novel genescaffold:turTru1:GeneScaffold_1115:213082:241405:1 gene:ENSTTRG00000007946 transcript:ENSTTRT00000007945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHSEVEILDAKTREKLCFLDKVEPQATIAEIKNLFTKSHPQWYPARQSLRLDPKGKSLK
DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGHKYDFT
SSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN
HPLYTPPTYGAQQVKLALAIFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTKNPFTWLF
LLVSCPNYTYEVGSWIGFAIMTQCLPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLR
MPIIPFLL
Download sequence
Identical sequences XP_004277460.1.21590 ENSTTRP00000007519 ENSTTRP00000007519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]