SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007546 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007546
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000122
Family Ubiquitin-related 0.0000712
Further Details:      
 
Domain Number 2 Region: 333-376
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000766
Family UBA domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007546   Gene: ENSTTRG00000007974   Transcript: ENSTTRT00000007973
Sequence length 380
Comment pep:novel genescaffold:turTru1:GeneScaffold_3560:224589:237046:-1 gene:ENSTTRG00000007974 transcript:ENSTTRT00000007973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSDWHLAVKLADQPLAPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPEL
IDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAALREFRVLHTAL
HSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVP
AHPALVNAIVLVLHSVAGSTPLPGADSSSRGMPSSSYRDMPGGFLFEGLSDDEDDFHPSA
RSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGT
SPVSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRAL
QATGGDIQAALELIFAGGAP
Download sequence
Identical sequences XP_004276349.1.21590 XP_007113804.1.24612 XP_007113805.1.24612 XP_019805137.1.83887 XP_019805146.1.83887 ENSTTRP00000007546 ENSTTRP00000007546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]