SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007630 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007630
Domain Number 1 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 412-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 362-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 11-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 7 Region: 255-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000169
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 8 Region: 88-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000813
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 9 Region: 213-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000213
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000007630
Domain Number - Region: 157-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00317
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007630   Gene: ENSTTRG00000008047   Transcript: ENSTTRT00000008063
Sequence length 570
Comment pep:novel scaffold:turTru1:scaffold_86142:6351:16839:-1 gene:ENSTTRG00000008047 transcript:ENSTTRT00000008063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAPRDPRQQVGVTFEDIAVYFSWEEWRLLDEAQIRLYLDVMLENYALISSVGCCCGA
EDAEAPFEQIASLGMSQARTPKAALCSQKTHPCEMCGPVLRNVFHLAEDQETQHSQKLLR
CGACVKLFYFSANFKQHQRQHMGEKTLRSSVDEALFVKSCRFHVSQKPFTCREFEKDFLT
IVGHLQQQASCTVEKPNTITQCESTSQGRRGHHTWGECKKALSLKHTLVQDQWVHTGRPC
FVCSECGKTFRYKSICCHQRVHAGERLHVCGEFGKSFRELNLSQHQSIHSGKAYKCSKCG
KSFSYVCSLTYHQRSHTGERPYECSDCGKSFISRPALRYHQRSHTGERPYECSECGKSFH
LYFIHQRVHTGERPYECSECGKSFNNRWVLIQHQRVHTGERPYECSECGKLFKYGSQLNQ
HQKAHTGEKPFKCTECGKSFNNRWTLIQHWRVHTGERPFECSECGKSFNRRNNLILHQRI
HTGERPYVCNECGKSFTFSSSLRYHQRAHTGERPYECSECGKSFISRSDLHYHQRVHSGE
RPYECSECGKSFIQRNNLIIHQSSHRRKAL
Download sequence
Identical sequences ENSTTRP00000007630 ENSTTRP00000007630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]