SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008075 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008075
Domain Number 1 Region: 57-117
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.15e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 570-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 7 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 238-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000446
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 323-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000229
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008075   Gene: ENSTTRG00000008522   Transcript: ENSTTRT00000008520
Sequence length 661
Comment pep:novel genescaffold:turTru1:GeneScaffold_3483:72279:81676:-1 gene:ENSTTRG00000008522 transcript:ENSTTRT00000008520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVVVSDETPGPSNQLCIRDTKLLQERALPSPHCPAFAEDGSQGSLPGAKIILMSQSQE
AVTFEDVAVNFSNEEWQCLTHAQRHLYKDVMLENYGNVVSLGFPFPKPPLISHLEQEAEL
CVQDGQDREFLSCPHPVSAAKTRPENEKASSEQAVFENGEVCWVKFKSLLKVVSQDPEVG
EVCVQDVKLENQWEIPMREKLREEKERCEKVTFKKGKNQKVLRKNSKCIPYRLLTEKKLH
ECARCDKNFIWHSDLILHERIHSCQKPYVCNECGKAFRTKNQLSMHQIIHTGEKPFNCSQ
CGKAFNSRSALCRHKKTHSGEKPHQCSDCGKAFKTRNRLRMHQIIHTGEKPYECSGCGKA
FQFKHSLIIHGRSHTGEKPYECEECGKAFSGSSDLIKHTRIHTGERPYECSECGRAFSRS
SDLSKHTRIHTQEKHCGCPQCGKAFSSKAELTKHRRIHTEEKPYKCKECGKAFRHNCKRR
AHEREHTGEKPYRCGDCGKTFQDRHCLTIHQRIHTGEKPYKCSECGRAFSGKSNLTNHQR
IHTGEKPYRCEVCGKAFHHSSVLRQHRRIHTGEKPYTCSECGTSFRQSSALIGHKRVHTG
EKPYECEECGKAFRVSSNLTGHKKRKHRVWGTHKLDENGKSLSPVTCSQTFSFINILTTN
T
Download sequence
Identical sequences ENSTTRP00000008075 ENSTTRP00000008075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]