SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008104 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008104
Domain Number 1 Region: 18-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-19
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000108
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000226
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 153-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000019
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008104   Gene: ENSTTRG00000008551   Transcript: ENSTTRT00000008549
Sequence length 490
Comment pep:novel genescaffold:turTru1:GeneScaffold_3483:152609:156429:-1 gene:ENSTTRG00000008551 transcript:ENSTTRT00000008549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFDLLKPTEPGECWWKAWVKKPVTSEDVAVNFNQEEWECLDASQRVLYQDVMSETFRNLM
SVVRIFLSNPDLIAKFEQEEKQWRAGLRPPNGEGLHSGGKREELQEQSQSLGDEGNSDDK
KVSLACRRAGPSSAPTGSLDRTAVFPASWAGPPFTCHTCGRCFSKRSSLYNHQFVHSCGQ
CGKSFLNPKDLSYHRRKHLGERPFCCSLCDKTYCDASGLSRHRRVHLGYRPHSCPFCGKC
FRDQSELKRHQKIHQGQELGAGNQKHILKIPDNTAGFQGLATANNAPVAGTQPSFKTAGP
EAQTQPSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCPHCPLTFSKKSCL
SSHQKAHFTEQSNCCFHCGKSFTLFSGLVRHQQTHWKQKLYCCPICDVCFGEKEDLLGHW
GGYRGKGLCLGSPHKCWAILGQSLGFFPDAPTVAGEDGSFSWIHTLRRRKGGEKARGKKA
DKAVKVLECK
Download sequence
Identical sequences ENSTTRP00000008104 ENSTTRP00000008104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]