SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008182 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008182
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.21e-22
Family Ubiquitin-related 0.0000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008182   Gene: ENSTTRG00000008631   Transcript: ENSTTRT00000008631
Sequence length 67
Comment pep:novel genescaffold:turTru1:GeneScaffold_3576:214169:223630:-1 gene:ENSTTRG00000008631 transcript:ENSTTRT00000008631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQIDETAADYKIL
GGSVLHL
Download sequence
Identical sequences ENSTTRP00000008182 ENSTTRP00000008182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]