SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008276 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008276
Domain Number 1 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 248-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-24
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 4-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 210-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-20
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 7 Region: 490-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 8 Region: 407-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000114
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008276   Gene: ENSTTRG00000008730   Transcript: ENSTTRT00000008729
Sequence length 552
Comment pep:novel scaffold:turTru1:scaffold_86984:40847:57194:-1 gene:ENSTTRG00000008730 transcript:ENSTTRT00000008729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNQVTFEDVAITFSREEWECLDPAQRALYRDVMLETYGNLLSLAVSHIHVIKKLKPKA
NSDRGEVFQTVMLGRHESHEIRDFYFREIQEDMHVFECQWRDDERNYKGMPITHSENLTD
RKNQHGGRDTGNKLIENKLTLSFRDELHIFKSEEKFDQFNQADKSINSSTSFLPLQTISS
IVQTNISSTYKSDFMHPSVLTQDQKAYKEKPYKCNECGKTFPYGSNLSRHQLIHTGEKPY
NCDVCGKVFSRNSHLACHQRIHTGERPYTCKECGKAFNQRSNLTRHQVIHTREKAYECDV
CGKVFSRKSILGSHQTVHFGEKSYTCNECGKAFRKHSSLTQHKRIHTGEKPYLCVECGKA
FRKHSNLTQHKTIHTGEKPYRCNECGKAFSVHSALRNHRIIHTGEKPYKCDVCGKVFSRN
SVLASHQRLHTGEKPYKCQECGRSFIQRSLLWIHEKIHTGEKPYKCNECGKAFPVRSILT
QHMRIHTGEKPYICVECGKAFTKHSNLTQHKTIHTGEKPYKCEECGRAFTQISSLSRHQR
RHTGKETSKRTQ
Download sequence
Identical sequences ENSTTRP00000008276 ENSTTRP00000008276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]