SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008308 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008308
Domain Number 1 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.47e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 610-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.55e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 666-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 506-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.06e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 28-74
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 319-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000309
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 708-756
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000392
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008308   Gene: ENSTTRG00000008772   Transcript: ENSTTRT00000008763
Sequence length 796
Comment pep:novel genescaffold:turTru1:GeneScaffold_3302:5969:23370:1 gene:ENSTTRG00000008772 transcript:ENSTTRT00000008763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSRDTAFVQVRRHKQEAAGTGIERQATSQSLLTFGDVAVEFSPEEWEWLDSAQRSLYRS
VMLENYRSLVSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRALPKTKELSSKKS
FCEEKSSQAVLMERPTTYSLECSVLGEDWGYSAVLERHLXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQSIHETQEL
FPKQDSFAEVVTDRTSNTNLESSTFRGSWDSEGLFERKLAGQKTQFRQEAVTHNKTLSKE
RECPYNKSGRWFHLDISEERVHRCDSVKKTFLSSSVVIKHAWIYAGKLFKCNECKKTFTQ
SSSLTVHQRVHTAEKPYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXHQRVHSGEKPFKCKECGKAFRQNIHLASHLRIH
TGEKPFECGECGKSFSISSQLATHQRIHTGEKPYACKVCSKAFTQKAHLAQHQKTHTGEK
PYECKECGKAFSQTTHLIQHQRVHTGEKPYKCMECGKAFGDNSSCTQHQRLHTGQRPYEC
IECGKAFKTKSSLICHRRSHTGEKPYECSACGKAFSHRQSLSVHQRIHSGKKPYECKECR
KTFIQIGHLNQHKRVHTGERPHNHKRSRKVFRQSTHFAHQRIHTGESPARPSLPATSNPV
DLLPKFLWNPPSLPSL
Download sequence
Identical sequences ENSTTRP00000008308 ENSTTRP00000008308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]