SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008316 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008316
Domain Number 1 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-25
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 3 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.06e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 601-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 18-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 376-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 647-699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 480-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000184
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 10 Region: 564-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000533
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 11 Region: 339-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000151
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 12 Region: 199-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000179
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008316   Gene: ENSTTRG00000008787   Transcript: ENSTTRT00000008771
Sequence length 718
Comment pep:novel genescaffold:turTru1:GeneScaffold_3302:37650:47544:1 gene:ENSTTRG00000008787 transcript:ENSTTRT00000008771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNQEKEKMMGIELLKAMSLDSVSFTDIAIDFSKDEWEWLNLGQRTLYKKVMLENYRNLA
SLGLCISKPDVISLLEQDKEPWMLKGEITRGLPPDLEYVWMRKELSPNQDIYEEKLSQAM
IMERLTGCDLKCSTLGENWKREDLFERELVSQKTHFRQETVSHIGTLIEKGDHCNKSGTV
FHLNTLSYIKQVFPIEERIYNFDTDKKSLKAHSFVKKHKQVYGEKKLWKCNDCEKTFSKI
STLTLHQRIHTGEKPYECIECGKAFSQSAHLAQHQRIHTGEKPFKCTECGKAFSQNAHLI
QHQRVHTGEKPYQCKQCHKAFSQLAHLAQHQRVHTGEKPYECIECGKAFSDCSSLAHHRR
IHSGKRPYECIDCGKAFRQNASLIRHRRYCHTGEKPFDCIDCGKAFTDHIGLIQHKRIHT
GERPYKCNVCGKAFSHGSSLTVHQRIHTGEKPYECNICEKAFSHRGSLTLHQRVHTGEKP
YECKECGKAFRQNTHLAHHQRIHTGEKPYKCKECSKAFSQNAHLAQHQKVHTGEKPYECK
VCGKAFSQIAHLIQHQRVHTGEKPYECIECGKAFSDGSYLVQHQRLHSGKRPYACLECGK
AFRQRATLICHQRCHTGEKPYECNVCGKAFSHRKSLTLHQRIHTGEKPYECKECSKAFNQ
IAHLTLHRRIHTGERPYECKECGKAFRQSVHLAHHQRIHTGESSSIIPSSSPAYYQVL
Download sequence
Identical sequences ENSTTRP00000008316 ENSTTRP00000008316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]