SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008373 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008373
Domain Number 1 Region: 713-900,1213-1296,1486-1547
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.48e-92
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000096
Further Details:      
 
Domain Number 2 Region: 158-336
Classification Level Classification E-value
Superfamily EF-hand 3.71e-26
Family Calmodulin-like 0.002
Further Details:      
 
Domain Number 3 Region: 350-404,499-566
Classification Level Classification E-value
Superfamily DUSP-like 2.88e-23
Family DUSP, domain in ubiquitin-specific proteases 0.0038
Further Details:      
 
Domain Number 4 Region: 2-144
Classification Level Classification E-value
Superfamily EF-hand 0.000000000169
Family Calmodulin-like 0.029
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000008373
Domain Number - Region: 626-685
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000465
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008373   Gene: ENSTTRG00000008802   Transcript: ENSTTRT00000008830
Sequence length 1585
Comment pep:novel genescaffold:turTru1:GeneScaffold_2515:49241:185957:-1 gene:ENSTTRG00000008802 transcript:ENSTTRT00000008830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDVELKRLKDAFKRTCGLSYYMGQHCFIREVLGDGVPPKVAEVIYCSFGGTSKGLHFNNL
IVGLVLLTRGRDEEKAKYIFSLFASESGSYVIREEMERMLHVVDGKVPDTLRKCFSEGEK
VNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTPTFYQTLAGVTHLEESDIIDLE
KRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAFDENRDNHIDFKEISCGLSAC
CRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVWKDNRTDDIPELHMDLSDIVE
GILNAHDTTKMGHLTLEDYQIWSVKNVLANEFLNLLFQVCHIVLGLRPATPEEEGQIIRG
WLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDASPVAIEPSSVLNGGKYLFGTAVHPI
EQSEDRIGGGSPSYVNTTEEKFSDNISTASEASETAGSGFLYSATPGADMCFARQHNTSD
NNNQCLLGTSGNILLHLNPQKPGAIDNQPLVTQEPVKATSLTLEGGRLKRTPQLIHGRDY
EMVPEPVWRALYHWYGANLALPRPVIKNSKTEIPELELFPRYLLFLRQQPATRTQQSNIW
VNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKEEDMRLWLYNSENYLTL
LDDEDHRLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKIDRHKVPTEKGATGLSNL
GNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQ
KNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRP
DWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYM
HLEITVITLDGTTPVRYGLRLNMDEKYTGLKKQLSDLCGLKSEQILLAEVHGSNIKNFPQ
DNQKVRLSVSGFLCAFEIPVPGSPISASSPVQTDFSSSPSTNGMFTLTTNGDLPRSIFIP
NGMPNTVVPCGTEKNFTNGMVNGHMPSLPDSSFTGYIIAVHRKMMRTELYFLSSQKNRPS
LFGMPLIVPCTAHTRKKDLYDAVWIQVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRV
VQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNAYIAVDWDPTALHLRYQTSQERVVDEH
ESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILX
XXXXXXXXXXXXXXXSQKIVKFPRESFDPSAFLVPRDPALCQRKPLTPQGDDLSEPRVLA
GEVKKMDAQNSAGEANMLLSKSPSSLSANVICSPKGSPSLSRKSGTSCPSSKNSSPNSSP
RTIGRSKGRLRLPQIGSKNKLSSSKENLDASKENGAGQVCELADALSRGHMLGGSQPELV
TPQDHEVALANGFLYEHEACGNGYSNGQFENHSEEDSTDDQREDIHVKPIYNLYAISCHS
GILGGGHYVTYAKNPNSRWYCYNDSSCKELHPDEIDTDSAYILFYEQQGIDYAQFLPKID
GKKMADTSSMDEDFESDYKKYCVLQ
Download sequence
Identical sequences ENSTTRP00000008373 ENSTTRP00000008373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]