SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008479 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008479
Domain Number 1 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.73e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 2 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.77e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 3 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-34
Family Ubiquitin-related 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008479   Gene: ENSTTRG00000008941   Transcript: ENSTTRT00000008941
Sequence length 229
Comment pep:novel scaffold:turTru1:scaffold_87178:16955:18100:-1 gene:ENSTTRG00000008941 transcript:ENSTTRT00000008941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
Download sequence
Identical sequences A0A091KEV9 A0A093GGT8 A0A0A0AEJ7 A0A1D5QQU2 A0A286XWK2 A7U5U2 D2HFP2 F6Q8N3 F6VNK4 F6YM88 F7E910 G1SF46 G2HGS8 J9JIJ3 M3WE01 P0CG47 P0CG60 P0CG65 P0CG67 Q5U5U6 Q95LX4 S9XGH7 W5P2Q8
gi|301617759|gb|XP_002938289| gi|301617761|gb|XP_002938290| ENSXETP00000057361 ENSSSCP00000019108 ENSAMEP00000020185 ENSNLEP00000013065 ENSNLEP00000022907 ENSMMUP00000035171 ENSOCUP00000001111 ENSPPYP00000009014 ENSMODP00000020484 ENSPVAP00000002420 ENSFCAP00000010056 ENSPPYP00000009014 ENSCJAP00000048788 ENSECAP00000002343 ENSMMUP00000035171 ENSAMEP00000020185 13616.ENSMODP00000020484 28377.ENSACAP00000013468 9544.ENSMMUP00000035171 9600.ENSPPYP00000009014 9606.ENSP00000304697 9796.ENSECAP00000002343 9823.ENSSSCP00000019108 9986.ENSOCUP00000001111 ENSOCUP00000001111 ENSGGOP00000000864 ENSPVAP00000002420 ENSMICP00000006531 ENSOARP00000004708 ENSTTRP00000008479 ENSGGOP00000000864 ENSMICP00000006531 ENSXETP00000057361 ENSP00000304697 NP_001009117.1.37143 NP_001098779.1.46622 NP_001181737.1.72884 NP_001268645.1.87134 NP_001268645.1.92137 NP_001268646.1.87134 NP_001268646.1.92137 NP_001268647.1.87134 NP_001268647.1.92137 NP_001268648.1.87134 NP_001268648.1.92137 NP_001268649.1.87134 NP_001268649.1.92137 NP_061828.1.87134 NP_061828.1.92137 XP_001087919.1.72884 XP_002748116.1.60252 XP_002827118.1.23681 XP_003282687.1.23891 XP_003282689.1.23891 XP_003466253.1.53824 XP_003732975.1.60252 XP_004042260.1.27298 XP_004042263.1.27298 XP_004042264.1.27298 XP_004091552.1.23891 XP_004091553.1.23891 XP_004092833.1.23891 XP_004092835.1.23891 XP_004446576.1.11602 XP_004870820.1.39548 XP_005142973.1.78019 XP_005142974.1.78019 XP_005654051.1.46622 XP_006779338.1.95426 XP_006901448.1.29581 XP_007057724.1.26238 XP_007057725.1.26238 XP_007943773.1.48129 XP_008493319.1.100939 XP_008995021.1.60252 XP_008995022.1.60252 XP_009881015.1.48241 XP_009901571.1.92783 XP_010007386.1.85724 XP_010014036.1.70042 XP_010014037.1.70042 XP_010014038.1.70042 XP_010014040.1.70042 XP_010116125.1.88979 XP_010135654.1.100080 XP_010135655.1.100080 XP_010135656.1.100080 XP_010386044.1.97406 XP_010972403.1.22495 XP_010973607.1.51371 XP_011830626.1.47321 XP_011830627.1.47321 XP_011830629.1.47321 XP_011885362.1.92194 XP_012356950.1.23891 XP_012359643.1.23891 XP_012359644.1.23891 XP_012603324.2.48125 XP_014422094.1.101512 XP_014974150.1.72884 XP_015292855.1.63531 XP_015292856.1.63531 XP_016786094.1.37143 XP_016786095.1.37143 XP_020136852.1.48125 ENSNLEP00000013065 ENSNLEP00000022907 ENSMODP00000020484 ENSTTRP00000008479 ENSP00000304697 ENSP00000379178 ENSP00000379180 ENSP00000478771 ENSECAP00000002343 ENSCJAP00000048788 ENSSSCP00000019108 gi|11024714|ref|NP_061828.1| ENSP00000304697 ENSP00000379178 ENSP00000379180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]