SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008550 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008550
Domain Number 1 Region: 37-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 160-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 340-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 218-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000291
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 6 Region: 255-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000151
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008550   Gene: ENSTTRG00000009019   Transcript: ENSTTRT00000009015
Sequence length 395
Comment pep:novel genescaffold:turTru1:GeneScaffold_1232:2841:9689:1 gene:ENSTTRG00000009019 transcript:ENSTTRT00000009015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATMVVSPTCAQSSLYPASHQKGCTEEEGLANGFLTNWLQHFVTFKDVARQFTQEEWALL
DPSHRTLYKDVVLENCRNLASLGNQIDKPSQISKLEQEDKVMTEERGITPDTCPDLEVLL
KAKGLTSKQHVFRKEQSKGITIEKRLLGVKLKECNQCFKVFSIKLNLTQQKTIHTGEEPY
HCNQCGKSFSSRSYLTVHKRIHNGEKPYGCNNCGKTFNSLRLHVRTHTGETYSCNQCFHV
FRTRCILKRHRRIHTRENHYECNQCGAFSMRSFLTGYNRIHMGEIYECSDCGKTFRKSSH
LMQHVRTHTGEKPCEFNDCGKSCSSSFSLTVHKRTHNREKPYKCSDCGKAFNNLSSVKKH
MRTRTGEKPYGCNHCGKSFSSNSYLSVHKRIHNRI
Download sequence
Identical sequences ENSTTRP00000008550 ENSTTRP00000008550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]