SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008560 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008560
Domain Number 1 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-27
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-26
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 278-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 43-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000248
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008560   Gene: ENSTTRG00000009049   Transcript: ENSTTRT00000009027
Sequence length 617
Comment pep:novel genescaffold:turTru1:GeneScaffold_1463:40106:54633:-1 gene:ENSTTRG00000009049 transcript:ENSTTRT00000009027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASACPLILTKPDTADRRRSVGTTGQAGCPPEMAVSEPGGSAAEWEQLDPAQKSLYKDV
MLENYSNLASMGYQALKPDISKLGKGEEPWLGKGKRPRQGGLSEIARPKGIGANGKVQQD
DDQLENHQESQNKLLGEVAFKKTTLTKKKGHECSSLGEKNVSTKYVPSKKKLLKFDSHGK
NLDLPGHVRNYVEKKPDVAKEHTKSFSHSLPDTKKDKNQTGKKCEKLPNHSSSNRPDKTQ
TGKKHTERNKIQTGEKHKESSSHSSSPTKCDKTQNKVKPYECNECGKVLSHKQGLVDHQR
IHTGEKPYECNECGIAFSQKSHLVVHQRTHTGEKPYECIQCGKAHGHKHALTDHLRVHTG
EKPYECTECGKTFRHSSNLIQHVRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPY
ECNECGKAFKYSSSLTKHMRIHTGEKPFQCSECGKAFSKKSHLIIHQRTHTKEKPYKCNE
CGKAFGHSSSLTYHMRTHTGESPFECNQCGKAFKQIEGLTQHQRVHTGEKPYECNECGKA
FTQKSHLIVHQRTHTGEKPYECNECGKAFNAKSQLVIHQRSHTGEKPYECNECGKAFKQN
ASLTKHMKTHSEDKSHE
Download sequence
Identical sequences ENSTTRP00000008560 ENSTTRP00000008560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]