SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008578 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008578
Domain Number 1 Region: 5-151,255-296
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.05e-38
Family FAD-linked reductases, N-terminal domain 0.000000568
Further Details:      
 
Domain Number 2 Region: 131-241
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.12e-35
Family L-aminoacid/polyamine oxidase 0.00000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008578   Gene: ENSTTRG00000009039   Transcript: ENSTTRT00000009047
Sequence length 359
Comment pep:novel genescaffold:turTru1:GeneScaffold_3257:2194:19517:1 gene:ENSTTRG00000009039 transcript:ENSTTRT00000009047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TARQFASLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSGQVSE
RIMHLLGDRVKLRCPVTYVDQSGDNIMIETLNHQLYECRYVISAVPPTLTAKIHFRPELP
SERNQLIQRLPMGNIIKCMMYYKEAFWKTPDYCGCMIIEDEEAPISITLDDTKPDGSLPA
IMGFILARKADRLAKVHKELRKRKICELYAKVLGSQEALQPVHYEEKNWCEEQYSGGCYT
AYFPPGIMTQYGRVIRQPVGRIYFAGTETATQWSGYMEGAVQAGERAAREVLNALGKVAK
KDIWVQEPESEDVPAVEITHTFWERNLPSVTGLLKIVGFSTSITALWFAACKFRLLTRC
Download sequence
Identical sequences ENSTTRP00000008578 ENSTTRP00000008578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]